RPL11, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-199	100 μL

Catalog No. 89-130-199 Supplier Abnova Corporation Supplier No. PAB28685

Description

Rabbit polyclonal antibody raised against recombinant RPL11.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L5P family of ribosomal proteins. It is located in the cytoplasm. The protein probably associates with the 5S rRNA. Alternative splice variants encoding different isoforms may exist, but they have not been fully characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq

Sequence: RAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEE

Specifications

• Antigen: RPL11
• Applications: Immunohistochemistry
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant RPL11.
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: RPL11
• Gene Alias: GIG34
• Gene Symbols: RPL11
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human RPL11.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6135
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only