RSHL3 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-483	100 μL

Catalog No. 89-124-483 Supplier Abnova Corporation Supplier No. PAB22777

Description

Rabbit polyclonal antibody raised against recombinant RSHL3.

This gene encodes a protein that appears to be a component the radial spoke head, as determined by homology to similar proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates. Radial spokes, which are regularly spaced along cilia, sperm, and flagella axonemes, consist of a thin 'stalk' and a bulbous 'head' that form a signal transduction scaffold between the central pair of microtubules and dynein. Mutations in this gene cause primary ciliary dyskinesia 1, a disease arising from dysmotility of motile cilia and sperm. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI

Specifications

• Antigen: RSHL3
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant RSHL3.
• Dilution: Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: RSHL3
• Gene Alias: FLJ37974/MGC126303/dJ412I7.1
• Gene Symbols: RSHL3
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human RSHL3.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 345895
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only