SELM, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-128-986	100 μL

Catalog No. 89-128-986 Supplier Abnova Corporation Supplier No. PAB27474

Description

Rabbit polyclonal antibody raised against recombinant SELM.

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This gene is expressed in a variety of tissues, and the protein is localized to the perinuclear structures. [provided by RefSeq]

Sequence: QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA

Specifications

• Antigen: SELM
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant SELM.
• Dilution: Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene: SELM
• Gene Alias: MGC40146/SEPM
• Gene Symbols: SELM
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human SELM.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 140606
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only