Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89117775

Sept8, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89117775 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-117-775 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-117-775 Supplier Abnova Corporation Supplier No. PAB15710
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against partial recombinant Sept8.

Sequence: AVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRIHQEEKRKVEEKRRELEEETNAFNCRKAAMEALQSQALHATSQQPLRKDKDKKN

Specifications

Antigen Sept8.
Applications Immunohistochemistry (Frozen), Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Sept8.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Sept8
Gene Alias AW046166/Sepl/mKIAA0202
Gene Symbols Sept8
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 192 mouse Sept8.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20362
Test Specificity Specific to recombinant protein GX0010. This antibody detects endogenous mSEPT8 protein in several cell types. It also recognizes human SEPT8 protein.
Target Species Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.