SF3B14 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SF3B14.

Supplier:  Abnova Corporation PAB22831

Catalog No. 89-124-538

Description

This gene encodes a 14kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site. [provided by RefSeq

Sequence: YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP

Specifications

• Antigen: SF3B14
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SF3B14.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CGI-110/HSPC175/Ht006/P14/SAP14/SF3B14a
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 51639
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: SF3B14
• Gene Symbols: SF3B14
• Immunogen: Recombinant protein corresponding to amino acids of human SF3B14.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only