Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SF4, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SF4.

Manufacturer:  Abnova Corporation PAB20289

Catalog No. 89-121-793


Add to cart

Description

Description

SF4 is a member of the SURP family of splicing factors.[supplied by OMIM

Sequence: GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT
Specifications

Specifications

SF4
Unconjugated
Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
SF4
DKFZp434E2216|F23858|RBP
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant SF4.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
SF4
Recombinant protein corresponding to amino acids of human SF4.
Antigen affinity purification
RUO
Primary
57794
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only