Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89117846

Sh2b1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89117846 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-117-846 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-117-846 Supplier Abnova Corporation Supplier No. PAB15782
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against partial recombinant Sh2b1.

Sequence: ERWTHRFERLRLSRGGGTLKDGAGMIQREELLSFMGAEEAAPDPAGVGRGGGAAGLTSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSTITDVRTATALEMPDRENTFVVKVEGPSEYILETSDALHVKAWVSDIQECLSPGPCPAISPRPMTLPH

Specifications

Antigen Sh2b1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Sh2b1.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Sh2b1
Gene Alias AI425885/C530001K22Rik/Irip/SH2-B/SH2-Bb/Sh2bpsm1/mKIAA1299
Gene Symbols Sh2b1
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 171 amino acids of mouse Sh2b1.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20399
Test Specificity Specific to recombinant protein GX2547. This antibody detects mSH2B1 protein. It also recognizes human SH2B1 protein.
Target Species Human, Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.