SH2B3, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-121-802	100 μL

Catalog No. 89-121-802 Supplier Abnova Corporation Supplier No. PAB20298

Description

Rabbit polyclonal antibody raised against recombinant SH2B3.

T-cell activation requires stimulation of the T-cell receptor (TCR; see MIM 186880)-CD3 (see CD3Z; MIM 186780) complex, followed by recruitment of an array of intracellular signaling proteins (e.g., GRB2 (MIM 108355) and PLCG1 (MIM 172420)). Mediating the interaction between the extracellular receptors and intracellular signaling pathways are adaptor proteins such as LAT (MIM 602354), TRIM (MIM 604962), and LNK.[supplied by OMIM

Sequence: FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH

Specifications

• Antigen: SH2B3
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant SH2B3.
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: SH2B3
• Gene Alias: CELIAC13/LNK
• Gene Symbols: SH2B3
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human SH2B3.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10019
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only