SLC10A1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SLC10A1.

Supplier:  Abnova Corporation PAB27937

Catalog No. 89-129-459

Description

Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the bile duct, and the kidney with an apical localization (SLC10A2; MIM 601295), and the other being found in the basolateral membranes of hepatocytes (SLC10A1).[supplied by OMIM

Sequence: CYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGE

Specifications

• Antigen: SLC10A1
• Classification: Polyclonal
• Description: solute carrier family 10 (sodium/bile acid cotransporter family), member 1
• Gene: SLC10A1
• Gene Symbols: SLC10A1
• Immunogen: Recombinant protein corresponding to amino acids of human SLC10A1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: NTCP, NTCP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6554
• Content And Storage: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

For Research Use Only