Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89129459

SLC10A1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89129459 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-129-459 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-129-459 Supplier Abnova Corporation Supplier No. PAB27937

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit polyclonal antibody raised against recombinant SLC10A1.

Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the bile duct, and the kidney with an apical localization (SLC10A2; MIM 601295), and the other being found in the basolateral membranes of hepatocytes (SLC10A1).[supplied by OMIM

Sequence: CYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGE

Specifications

Antigen SLC10A1
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Formulation In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene SLC10A1
Gene Alias NTCP, NTCP1
Gene Symbols SLC10A1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human SLC10A1.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6554
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.