Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC19A1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SLC19A1.

Manufacturer:  Abnova Corporation PAB21962

Catalog No. 89-123-668


Add to cart

Description

Description

Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM

Sequence: AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV
Specifications

Specifications

SLC19A1
Unconjugated
Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
SLC19A1
CHMD|FOLT|IFC1|REFC|RFC1
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant SLC19A1.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
SLC19A1
Recombinant protein corresponding to amino acids of human SLC19A1.
Antigen affinity purification
RUO
Primary
6573
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only