Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89129788

SLC22A8 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89129788 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-129-788 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-129-788 Supplier Abnova Corporation Supplier No. PAB28282
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant SLC22A8.

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeq

Sequence: KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR

Specifications

Antigen SLC22A8
Applications Immunohistochemistry, Immunohistochemistry (Formalin/Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant SLC22A8.
Dilution Immunohistochemistry (1:2500-1:5000) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene SLC22A8
Gene Alias MGC24086/OAT3
Gene Symbols SLC22A8
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of recombinant SLC22A8.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9376
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.