SLC35B2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-027	100 μL

Catalog No. 89-124-027 Supplier Abnova Corporation Supplier No. PAB22320

Description

Rabbit polyclonal antibody raised against recombinant SLC35B2.

Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIM

Sequence: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT

Specifications

• Antigen: SLC35B2
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant SLC35B2.
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: SLC35B2
• Gene Alias: PAPST1/SLL/UGTrel4
• Gene Symbols: SLC35B2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human SLC35B2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 347734
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only