SLC43A2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SLC43A2.

Supplier:  Abnova Corporation PAB21430

Catalog No. 89-122-924

Description

System L amino acid transporters, such as SLC43A2, mediate sodium-independent transport of bulky neutral amino acids across cell membranes (Bodoy et al., 2005 [PubMed 15659399]).[supplied by OMIM

Sequence: YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV

Specifications

• Antigen: SLC43A2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SLC43A2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ23848/LAT4/MGC34680
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 124935
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: SLC43A2
• Gene Symbols: SLC43A2
• Immunogen: Recombinant protein corresponding to amino acids of human SLC43A2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only