SLC7A9 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-453	100 μL

Catalog No. 89-129-453 Supplier Abnova Corporation Supplier No. PAB27931

Description

Rabbit polyclonal antibody raised against recombinant SLC7A9.

This gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in the reabsorption of cystine in the kidney tubule. Mutations in this gene cause non-type I cystinuria, a disease that leads to cystine stones in the urinary system due to impaired transport of cystine and dibasic amino acids. Two transcript variants, which encode the same protein, have been found for this gene. [provided by RefSeq

Sequence: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE

Specifications

• Antigen: SLC7A9
• Applications: Immunohistochemistry, Immunohistochemistry (Formalin/Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant SLC7A9.
• Dilution: Immunohistochemistry (1:1000-1:2500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene: SLC7A9
• Gene Alias: BAT1/CSNU3/FLJ94301
• Gene Symbols: SLC7A9
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human SLC7A9.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11136
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only