Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89124717

SLCO4C1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124717 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-717 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-717 Supplier Abnova Corporation Supplier No. PAB23018

Description

Rabbit polyclonal antibody raised against recombinant SLCO4C1.

SLCO4C1 belongs to the organic anion transporter (OATP) family. OATPs are involved in the membrane transport of bile acids, conjugated steroids, thyroid hormone, eicosanoids, peptides, and numerous drugs in many tissues (Mikkaichi et al., 2004 [PubMed 14993604]).[supplied by OMIM

Sequence: AKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEF

Specifications

Antigen SLCO4C1
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description solute carrier organic anion transporter family, member 4C1
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene SLCO4C1
Gene Alias OATP-H, OATP-M1, OATP4C1, OATPX, PRO2176, SLC21A20
Gene Symbols SLCO4C1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human SLCO4C1.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 353189
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.