Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89129931

SNTB2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89129931 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-129-931 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-129-931 Supplier Abnova Corporation Supplier No. PAB28425

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit polyclonal antibody raised against recombinant SNTB2.

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq

Sequence: NRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRL

Specifications

Antigen SNTB2
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene SNTB2
Gene Alias D16S2531E, EST25263, SNT2B2, SNT3, SNTL
Gene Symbols SNTB2
Host Species Rabbit
Immunogen Recombinant protein corresponding to human SNTB2.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6645
Target Species Human, Mouse, Rat
Content And Storage Store at 4 °C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.