STAT6 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-007	100 μL

Catalog No. 89-130-007 Supplier Abnova Corporation Supplier No. PAB28498

Description

Rabbit polyclonal antibody raised against recombinant STAT6

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. [provided by RefSeq

Sequence: VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR

Specifications

• Antigen: STAT6
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant STAT6
• Dilution: Immunohistochemistry(1:50-1:200) Western Blot(1:100-1:250) Immunofluorescence(1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: STAT6
• Gene Alias: D12S1644/IL-4-STAT/STAT6B/STAT6C
• Gene Symbols: STAT6
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human STAT6
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6778
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only