Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89122028

SYT12, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122028 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-028 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-028 Supplier Abnova Corporation Supplier No. PAB20524
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant SYT12.

The SRG1 gene encodes a protein that is a member of a family of proteins involved in the regulation of transmitter release in the nervous system (Fernandez-Chacon et al., 2001 [PubMed 11242035]). The membrane-associated synaptic SRG1 protein is under thyroid hormone control during brain development (Thompson, 1996 [PubMed 8987811]).[supplied by OMIM

Sequence: LLSLSYLPTAERLTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLATLRRPVSMWHAV

Specifications

Antigen SYT12
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant SYT12.
Dilution Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene SYT12
Gene Alias SRG1/SYT11
Gene Symbols SYT12
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human SYT12.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 91683
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.