TAF4B, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TAF4B.

Supplier:  Abnova Corporation PAB22229

Catalog No. 89-123-934

Description

TATA-binding protein associated factors (TAFs) participate, with TATA binding protein (TBP; MIM 600075), in the formation of the TFIID protein complex (see MIM 313650), which is involved in the initiation of gene transcription by RNA polymerase II (see MIM 180660).[supplied by OMIM

Sequence: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT

Specifications

• Antigen: TAF4B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant TAF4B.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: TAF2C2/TAFII105
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 6875
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: TAF4B
• Gene Symbols: TAF4B
• Immunogen: Recombinant protein corresponding to amino acids of human TAF4B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only