TARBP1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-426	100 μL

Catalog No. 89-123-426 Supplier Abnova Corporation Supplier No. PAB21725

Description

Rabbit polyclonal antibody raised against recombinant TARBP1.

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. This element forms a stable stem-loop structure and can be bound by either the protein encoded by this gene or by RNA polymerase II. This protein may act to disengage RNA polymerase II from TAR during transcriptional elongation. Alternatively spliced transcripts of this gene may exist, but their full-length natures have not been determined. [provided by RefSeq

Sequence: MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG

Specifications

• Antigen: TARBP1
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant TARBP1.
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: TARBP1
• Gene Alias: FLJ30482/TRM3/TRP-185/TRP185
• Gene Symbols: TARBP1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human TARBP1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6894
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only