Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIMM9, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TIMM9.

Supplier:  Abnova Corporation PAB28616

Catalog No. 89-130-128


Add to Cart

Description

Description

TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM

Sequence: AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Specifications

Specifications

TIMM9
Polyclonal
Rabbit polyclonal antibody raised against recombinant TIMM9.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
TIM9/TIM9A
Rabbit
Antigen affinity purification
RUO
26520
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Immunohistochemistry (1:10-1:20) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
TIMM9
TIMM9
Recombinant protein corresponding to amino acids of human TIMM9.
100 μL
Primary
Human
Liquid
Recommendations

Recommendations

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only