TOM1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-988	100 μL

Catalog No. 89-129-988 Supplier Abnova Corporation Supplier No. PAB28480

Description

Rabbit polyclonal antibody raised against recombinant TOM1

This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ

Specifications

• Antigen: TOM1
• Applications: Immunohistochemistry, Western Blot, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant TOM1
• Dilution: Immunohistochemistry(1:50-1:200) Western Blot(1:250-1:500) Immunofluorescence(1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: TOM1
• Gene Alias: FLJ33404
• Gene Symbols: TOM1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human TOM1
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10043
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only