Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

TOX3, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TOX3.

Manufacturer:  Abnova Corporation PAB23652

Catalog No. 89-125-361



Description

Description

The protein encoded by this gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this gene

Sequence: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
Specifications

Specifications

TOX3
Unconjugated
Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
TOX3
CAGF9|TNRC9
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant TOX3.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
TOX3
Recombinant protein corresponding to amino acids of human TOX3.
Antigen affinity purification
RUO
Primary
27324
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only