Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM41 Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122857 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-857 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-857 Supplier Abnova Corporation Supplier No. PAB21366

Rabbit polyclonal antibody raised against recombinant TRIM41.

TRIM41 belongs to a family of tripartite motif (TRIM) proteins defined as containing a RING finger, one or more B-box domains, and a coiled-coil region (Tanaka et al., 2005 [PubMed 16022281]). See TRIM45 (MIM 609318).[supplied by OMIM

Sequence: YKAKLQGHVEPLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQL

Specifications

Antigen TRIM41
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description tripartite motif-containing 41
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene TRIM41
Gene Alias MGC1127, MGC31991, RINCK
Gene Symbols TRIM41
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human TRIM41.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 90933
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.