TRPC3 Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TRPC3.

Supplier:  Abnova Corporation PAB28559

Catalog No. 89-130-069

Description

Sequence: NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI

Specifications

• Antigen: TRPC3
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant TRPC3.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: TRP3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 7222
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry(1:50-1:200) Western Blot(1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene: TRPC3
• Gene Symbols: TRPC3
• Immunogen: Recombinant protein corresponding to amino acids of recombinant TRPC3.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only