TSSC4, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TSSC4.

Supplier:  Abnova Corporation PAB23855

Catalog No. 89-125-563

Description

This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the pan-hematopoietic expression gene (PHEMX), escapes imprinting. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeq

Sequence: TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD

Specifications

• Antigen: TSSC4
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant TSSC4.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Symbols: TSSC4
• Immunogen: Recombinant protein corresponding to amino acids of human TSSC4.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:1000-1:2500) The optimal working dilution should be determined by the end user.
• Gene: TSSC4
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 10078
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only