Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TUBGCP6 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TUBGCP6.

Supplier:  Abnova Corporation PAB28275

Catalog No. 89-129-780


Add to Cart

Description

Description

The protein encoded by this gene is part of a large multisubunit complex required for microtubule nucleation at the centrosome. [provided by RefSeq

Sequence: LDLLVQLAGSGPPQVLPRKRDYFLNNKHVGRNVPYSGYDCDDLSVFEMDVQSLISREECLCHSMIQETLQVMEAAPGTGLPTVGLFSFGDP
Specifications

Specifications

TUBGCP6
Polyclonal
Rabbit polyclonal antibody raised against recombinant TUBGCP6.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
GCP6
Rabbit
Antigen affinity purification
RUO
85378
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry (PFA fixed)
Unconjugated
Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
TUBGCP6
TUBGCP6
Recombinant protein corresponding to amino acids of recombinant TUBGCP6.
100 μL
Primary
Human
Liquid
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only