TYSND1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-463	100 μL

Catalog No. 89-124-463 Supplier Abnova Corporation Supplier No. PAB22755

Description

Rabbit polyclonal antibody raised against recombinant TYSND1.

All peroxisomal proteins are synthesized in the cytosol, and 2 distinct peroxisomal targeting signals (PTSs), the C-terminal PTS1 and N-terminal PTS2, are used for transport of these proteins into peroxisomes. Proteolytic cleavage of the N-terminal targeting sequence of PTS2 proteins accompanies import into peroxisomes, and many PTS1 proteins undergo C-terminal processing once in the peroxisomal matrix. TYSND1 processes both PTS1 and PTS2 proteins involved in beta-oxidation of fatty acids (Kurochkin et al., 2007 [PubMed 17255948]).[supplied by OMIM

Sequence: ATQETCPYDIAVVSLEEDLDDVPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAV

Specifications

• Antigen: TYSND1
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant TYSND1.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: TYSND1
• Gene Alias: FLJ40378/MGC131934/MGC34695
• Gene Symbols: TYSND1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human TYSND1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 219743
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only