Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89124940

UBIAD1 Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124940 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-940 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-940 Supplier Abnova Corporation Supplier No. PAB23239

Description

Rabbit polyclonal antibody raised against recombinant UBIAD1.

This gene encodes a protein thought to be involved in cholesterol and phospholipid metabolism. Mutations in this gene are associated with Schnyder crystalline corneal dystrophy. [provided by RefSeq

Sequence: YDFSKGIDHKKSDDRTLVDRILEPQDVVRF

Specifications

Antigen UBIAD1
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description UbiA prenyltransferase domain containing 1
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene UBIAD1
Gene Alias RP4-796F18.1, SCCD, TERE1
Gene Symbols UBIAD1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human UBIAD1.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29914
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.