Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UCHL5IP, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant UCHL5IP.

Manufacturer:  Abnova Corporation PAB20230

Catalog No. 89-121-737

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. [provided by RefSeq

Sequence: LGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSL
Specifications

Specifications

UCHL5IP
Unconjugated
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Affinity Purified
UCHL5IP
Recombinant protein corresponding to amino acids of human UCHL5IP.
Antigen affinity purification
RUO
Primary
55559
Immunofluorescence, Immunohistochemistry, Western Blot
UCHL5 interacting protein
UCHL5IP
HSXQ28ORF, UIP1
Rabbit
IgG
100μL
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only