UCHL5IP, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant UCHL5IP.

Supplier:  Abnova Corporation PAB20230

Catalog No. 89-121-737

Description

This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. [provided by RefSeq

Sequence: LGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSL

Specifications

• Antigen: UCHL5IP
• Classification: Polyclonal
• Description: UCHL5 interacting protein
• Gene: UCHL5IP
• Gene Symbols: UCHL5IP
• Immunogen: Recombinant protein corresponding to amino acids of human UCHL5IP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: HSXQ28ORF, UIP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55559
• Content And Storage: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

For Research Use Only