Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UCHL5IP, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89121737 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-121-737 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-121-737 Supplier Abnova Corporation Supplier No. PAB20230

Rabbit polyclonal antibody raised against recombinant UCHL5IP.

This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. [provided by RefSeq

Sequence: LGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSL

Specifications

Antigen UCHL5IP
Applications Immunofluorescence, Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description UCHL5 interacting protein
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene UCHL5IP
Gene Alias HSXQ28ORF, UIP1
Gene Symbols UCHL5IP
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human UCHL5IP.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55559
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.