USH1G, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-382	100 μL

Catalog No. 89-123-382 Supplier Abnova Corporation Supplier No. PAB21685

Description

Rabbit polyclonal antibody raised against recombinant USH1G.

This gene encodes a protein that contains three ankyrin domains, a class I PDZ-binding motif and a sterile alpha motif. The encoded protein interacts with harmonin, which is associated with Usher syndrome type 1C. This protein plays a role in the development and maintenance of the auditory and visual systems and functions in the cohesion of hair bundles formed by inner ear sensory cells. Mutations in this gene are associated with Usher syndrome type 1G (USH1G). [provided by RefSeq

Sequence: NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER

Specifications

• Antigen: USH1G
• Applications: Immunohistochemistry, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant USH1G.
• Dilution: Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: USH1G
• Gene Alias: ANKS4A/FLJ33924/SANS
• Gene Symbols: USH1G
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human USH1G.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 124590
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only