Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123819

VAV3, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89123819 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-819 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-819 Supplier Abnova Corporation Supplier No. PAB22112

Description

Rabbit polyclonal antibody raised against recombinant VAV3.

This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: AHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAI

Specifications

Antigen VAV3
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description vav 3 guanine nucleotide exchange factor
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene VAV3
Gene Alias FLJ40431
Gene Symbols VAV3
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human VAV3.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10451
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.