Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89124389

VWA1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124389 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-389 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-389 Supplier Abnova Corporation Supplier No. PAB22680

Description

Rabbit polyclonal antibody raised against recombinant VWA1.

VWA1 belongs to the von Willebrand factor (VWF; MIM 193400) A (VA) domain superfamily of extracellular matrix proteins and appears to play a role in cartilage structure and function (Fitzgerald et al., 2002 [PubMed 12062410]).[supplied by OMIM

Sequence: PRGDLMFLLDSSASVSHYEFSRVREFVGQLVAPLPLGTGALRASLVHVGSRPYTEFPFGQHSSGEAAQDAVRA

Specifications

Antigen VWA1
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description von Willebrand factor A domain containing 1
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene VWA1
Gene Alias DKFZp761O051, FLJ22215, VWA-1, WARP
Gene Symbols VWA1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human VWA1.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64856
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.