Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WBSCR17, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122168 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-168 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-168 Supplier Abnova Corporation Supplier No. PAB20665
Only null left
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against recombinant WBSCR17.

This gene encodes an N-acetylgalactosaminyltransferase, which has 97% sequence identity to the mouse protein. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq

Sequence: RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE

Specifications

Antigen WBSCR17
Applications Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant WBSCR17.
Dilution Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene WBSCR17
Gene Alias DKFZp434I2216/DKFZp761D2324/GALNT16/GALNT20/GALNTL3
Gene Symbols WBSCR17
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human WBSCR17.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64409
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.