Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89124912

WDR63, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124912 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-912 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-912 Supplier Abnova Corporation Supplier No. PAB23212

Description

Rabbit polyclonal antibody raised against recombinant WDR63.

Sequence: IEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTEKAEEMNPYHNLESGMANLLKPI

Specifications

Antigen WDR63
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description WD repeat domain 63
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene WDR63
Gene Alias FLJ30067, NYD-SP29, RP11-507C22.2
Gene Symbols WDR63
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human WDR63.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 126820
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.