WRAP73, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-693	100 μL

Catalog No. 89-123-693 Supplier Abnova Corporation Supplier No. PAB21986

Description

Rabbit polyclonal antibody raised against recombinant WRAP73.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Studies of the related mouse protein suggest that the encoded protein may play a role in the process of ossification. [provided by RefSeq

Sequence: SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM

Specifications

• Antigen: WRAP73
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant WRAP73.
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: WRAP73
• Gene Alias: RP11-46F15.4/WDR8
• Gene Symbols: WRAP73
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human WRAP73.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 49856
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only