Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89122166

ZCCHC14, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122166 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-166 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-166 Supplier Abnova Corporation Supplier No. PAB20662

Description

Rabbit polyclonal antibody raised against recombinant ZCCHC14.

Sequence: IHLESSDKEKPVMLLNHFTSSSARPTAQVLPVQNEASSNPSGHHPLPPQMLSAASHITPIRMLNSVHKPERGSADMKLLSSSVHSLLSLEERNKGSGPRSSMKVD

Specifications

Antigen ZCCHC14
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description zinc finger, CCHC domain containing 14
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene ZCCHC14
Gene Alias BDG-29, BDG29, MGC126527, MGC14139
Gene Symbols ZCCHC14
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human ZCCHC14.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23174
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.