Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89117785

Zfp292, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89117785 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-117-785 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-117-785 Supplier Abnova Corporation Supplier No. PAB15720
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against partial recombinant Zfp292.

Sequence: PMGFEASFLKFLEESAVKQKKNSDRDHSNSGSKRGSHSSSRRHVDKAAVAGSSHVCSCKDSEIFVQFANPSKLQCSENVKIVLDKTLKDRSELVLKQLQEMKPTVSLKKLEVLSNNPDRTVLKEISIGKATGRGQY

Specifications

Antigen Zfp292
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Zfp292.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Zfp292
Gene Alias 5730450D02Rik/5830493J20Rik/9430062L07Rik/AI449016/Krox-10/Zfp-15/Zfp15/Zn-15/Zn-16/mKIAA0530
Gene Symbols Zfp292
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 136 mouse Zfp292.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 30046
Test Specificity Specific to recombinant protein GX0006. This antibody detects mZFP292 protein.
Target Species Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.