ZKSCAN5, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-230	100 μL

Catalog No. 89-130-230 Supplier Abnova Corporation Supplier No. PAB28714

Description

Rabbit polyclonal antibody raised against recombinant ZKSCAN5.

This gene encodes a zinc finger protein of the Kruppel family. The protein contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. Two alternatively spliced transcript variants differing only in the 5' UTR have been described. Additional variants have been found, but their full-length sequences have not been determined. [provided by RefSeq]

Sequence: EHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITS

Specifications

• Antigen: ZKSCAN5
• Applications: Immunohistochemistry, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ZKSCAN5.
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: ZKSCAN5
• Gene Alias: FLJ39233/KIAA1015/MGC33710/ZFP95
• Gene Symbols: ZKSCAN5
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human ZKSCAN5.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23660
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only