Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF670, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ZNF670.

Supplier:  Abnova Corporation PAB28743

Catalog No. 89-130-262


Add to Cart

Description

Description

Sequence: DVAVAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPC
Specifications

Specifications

ZNF670
Polyclonal
Rabbit polyclonal antibody raised against recombinant ZNF670.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
FLJ12606/MGC12466
Rabbit
Antigen affinity purification
RUO
93474
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry, Western Blot
Unconjugated
Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
ZNF670
ZNF670
Recombinant protein corresponding to amino acids of human ZNF670.
100 μL
Primary
Human
Liquid
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only