Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZRANB1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ZRANB1.

Manufacturer:  Abnova Corporation PAB22259

Catalog No. 89-123-965


Add to cart

Description

Description

Sequence: RPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLP
Specifications

Specifications

ZRANB1
Unconjugated
Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
ZRANB1
DKFZp762P2216|TRABID
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant ZRANB1.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
ZRANB1
Recombinant protein corresponding to amino acids of human ZRANB1.
Antigen affinity purification
RUO
Primary
54764
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only