ZSCAN2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-378	100 μL

Catalog No. 89-123-378 Supplier Abnova Corporation Supplier No. PAB21681

Description

Rabbit polyclonal antibody raised against recombinant ZSCAN2.

The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq

Sequence: ATHRRTHMVEKPYKCGVCGKSFSQSSSLIAHQGMHTGEKPYECLTCGESFSWSSNLLKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLII

Specifications

• Antigen: ZSCAN2
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ZSCAN2.
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: ZSCAN2
• Gene Alias: FLJ20595/ZFP29/ZNF854
• Gene Symbols: ZSCAN2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human ZSCAN2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54993
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only