RABIF/MSS4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18102425UL

Catalog No. NB419179

Description

RABIF/MSS4 Polyclonal specifically detects RABIF/MSS4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RABIF/MSS4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: mammalian suppressor of SEC4, mss4, MSS4guanine nucleotide exchange factor MSS4, RAB interacting factor, Rab-interacting factor, RASGFR3, RASGRF3, Ras-specific guanine-releasing factor 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RABIF
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPD
• Quantity: 25ul
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5877
• Target Species: Human
• Isotype: IgG

For Research Use Only