Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ RABL2A Recombinant Protein Antigen
SDP

Catalog No. NBP246681X
Click to view available options
Protein Length:
DKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATV
KLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPS

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RABL2A The RABL2A Recombinant Protein Antigen is derived from E. coli. The RABL2A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Protein Length KLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPS
Purity >80% by SDS-PAGE and Coomassie blue staining
Common Name RABL2A Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) AC
Gene Alias FLJ78724, MGC117180
Gene Symbol RABL2A
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 0.1 mL
Regulatory Status RUO
Source E.coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.