RACK1/GNB2L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158959

Catalog No. NBP158959

Description

RACK1/GNB2L1 Polyclonal specifically detects RACK1/GNB2L1 in Human, Invertebrate samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RACK1/GNB2L1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: guanine nucleotide binding, guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1, Receptor for activated C kinase, Receptor for Activated C Kinase 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 10399
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
• Gene Accession No.: P63244
• Gene Symbols: GNB2L1
• Immunogen: Synthetic peptides corresponding to GNB2L1(guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1) The peptide sequence was selected from the N terminal of GNB2L1 (NP_006089). Peptide sequence ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta-2-like 1.
• Target Species: Human, Invertebrate, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
• Isotype: IgG