Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RACK1/GNB2L1 Antibody, Novus Biologicals™

RACK1/GNB2L1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158959 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158959 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158959 Supplier Novus Biologicals Supplier No. NBP158959
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RACK1/GNB2L1 Polyclonal specifically detects RACK1/GNB2L1 in Human, Invertebrate samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RACK1/GNB2L1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P63244
Gene Alias guanine nucleotide binding, guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1, Receptor for activated C kinase, Receptor for Activated C Kinase 1
Gene Symbols GNB2L1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GNB2L1(guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1) The peptide sequence was selected from the N terminal of GNB2L1 (NP_006089). Peptide sequence ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 35 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10399
Test Specificity This product is specific to Subunit or Isoform: beta-2-like 1.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Invertebrate, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.