Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ RAD51 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595579
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595579 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595579 Supplier Invitrogen™ Supplier No. PA595579
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A431 whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, human A549 whole cell, human Caco-2 whole cell, rat testis tissue, mouse testis tissue, mouse thymus tissue. IHC: human placenta tissue, human testis tissue, mouse brain tissue, rat brain tissue. ICC/IF: U20S cell. Flow: SiHa cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

RAD51 plays a critical role in homologous strand exchange, a key step in DNA repair through homologous recobination. It binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. RAD51 catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. It binds to a single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Mutations in the gene can results in breast cancer, mirror movements 2 and fanconi anemia.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAD51
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Rad51
Gene Accession No. Q06609, Q08297
Gene Alias AV304093; BRCA1/BRCA2-containing complex, subunit 5; BRCC5; DNA repair protein RAD51; DNA repair protein RAD51 homolog 1; DNA repair protein RAD51 homolog A; DNA repair protein rhp51; FANCR; homolog to S.cerevisiae; HRAD51; HsRad51; HsT16930; MGC128559 protein; MRMV2; MUT5; rad51; RAD51 homolog; RAD51 homolog (RecA homolog); RAD51 homolog (RecA homolog, E. coli); RAD51 homolog A; RAD51 recombinase; RAD51 recombinase L homeolog; rad51.1; rad51.L; rad51-1; RAD51A; rad51-a; rad51-b; Reca; RecA family recombinase Rhp51; RecA, E. coli, homolog of; RecA-like protein; recombinase RAD51; recombination protein A; RGD1563603; rhp51; SPAC644.14c; wu:fb38e12; xrad51; XRad51.1; YER095W; zgc:77754
Gene Symbols Rad51
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 19361, 499870, 5888
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.