Rad51L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25504625UL

Catalog No. NB404056

Description

Rad51L1 Polyclonal specifically detects Rad51L1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Rad51L1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: DNA repair protein RAD51 homolog 2, MGC34245, R51H2REC2hREC2, RAD51 (S. cerevisiae)-like 1, RAD51 homolog B, RAD51B, RAD51-like 1 (S. cerevisiae), RAD51-like protein 1, RecA-like protein, recombination repair protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RAD51B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI
• Quantity: 25 μL
• Research Discipline: Breast Cancer, Cancer, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination
• Gene ID (Entrez): 5890
• Target Species: Human
• Isotype: IgG

For Research Use Only