Rad9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25638325UL

Catalog No. NB394509

Description

Rad9 Polyclonal specifically detects Rad9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Rad9
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: cell cycle checkpoint control protein RAD9A, DNA repair exonuclease rad9 homolog A, EC 3.1.11.2, hRAD9, RAD9, RAD9 (S. pombe) homolog, RAD9 homolog A (S. pombe)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RAD9A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LFFQQYQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGI
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Checkpoint signaling, Chromatin Research, DNA Repair, Tumor Suppressors
• Gene ID (Entrez): 5883
• Target Species: Human
• Form: Purified

For Research Use Only