Invitrogen™ RAGE Monoclonal Antibody (5C6C1)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549253

Catalog No. PIMA549253

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse and rat sequences by six amino acids. Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: mouse lung tissue, rat lung tissue, rat lung tissue. Flow: Jurkat cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-β peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-?B activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.

Specifications

• Antigen: RAGE
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: Q15109, Q62151, Q63495
• Gene Symbols: AGER
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Clone: 5C6C1
• Conjugate: Unconjugated
• Gene: AGER
• Gene Alias: advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11596, 177, 81722
• Content And Storage: -20°C
• Form: Lyophilized