Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RALYL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | RALYL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180484
![]() |
Novus Biologicals
NBP180484 |
100 μL |
Each for $480.74
|
|
|||||
NBP18048420
![]() |
Novus Biologicals
NBP18048420UL |
20 μL | N/A | N/A | N/A | ||||
Description
RALYL Polyclonal specifically detects RALYL in Human samples. It is validated for Western Blot.Specifications
| RALYL | |
| Polyclonal | |
| Rabbit | |
| NP_776247 | |
| 138046 | |
| Synthetic peptide directed towards the C terminal of human RALYL. Peptide sequence AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hnRNP core protein C-like 3, HNRPCL3Heterogeneous nuclear ribonucleoprotein C-like 3, hRALYL, RALY RNA binding protein-like, RNA-binding Raly-like protein | |
| RALYL | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title